Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells, K-562 cells, THP-1 cells, rat spleen tissues |
Positive IHC detected in | human appendicitis tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67320-1-Ig targets ARPC1B in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples.
Tested Reactivity | Human, rat, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29095 Product name: Recombinant human ARPC1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 265-372 aa of BC007555 Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK Predict reactive species |
Full Name | actin related protein 2/3 complex, subunit 1B, 41kDa |
Calculated Molecular Weight | 41 kDa |
Observed Molecular Weight | 38 kDa |
GenBank Accession Number | BC007555 |
Gene Symbol | ARPC1B |
Gene ID (NCBI) | 10095 |
RRID | AB_2882580 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O15143 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ARPC1B antibody 67320-1-Ig | Download protocol |
IHC protocol for ARPC1B antibody 67320-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |