ARPC1B Monoclonal antibody, PBS Only

• 

  WB analysis using 67320-1-Ig (same clone as 67320-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67320-1-Ig (ARPC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67320-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 67320-1-Ig (same clone as 67320-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 67320-1-Ig (ARPC1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67320-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 67320-1-Ig (same clone as 67320-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 67320-1-Ig (ARPC1B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67320-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 67320-1-Ig (same clone as 67320-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 67320-1-Ig (ARPC1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67320-1-PBS in a different storage buffer formulation.

ARPC1B Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67320-1-PBS

Clone No.2C8A1

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ARC41, Arp2/3 complex 41 kDa subunit, ARPC1B, p40 ARC, p41 ARC

---

Product Information

67320-1-PBS targets ARPC1B in WB, IHC, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29095

  Product name: Recombinant human ARPC1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 265-372 aa of BC007555

  Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

• Full Name: actin related protein 2/3 complex, subunit 1B, 41kDa
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC007555
• Gene Symbol: ARPC1B
• Gene ID (NCBI): 10095
• RRID: AB_2882580
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15143
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.