ARPC5 Polyclonal antibody

• 

  WB analysis of mouse brain using 16717-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16717-1-AP (ARPC5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16717-1-AP

  Rat brain lysates were subjected to SDS PAGE followed by western blot with 16717-1-AP (ARPC5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 16717-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16717-1-AP (ARPC5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 16717-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 16717-1-AP (ARPC5 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse kidney using 16717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16717-1-AP (ARPC5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16717-1-AP (ARPC5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16717-1-AP (ARPC5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16717-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16717-1-AP (ARPC5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Neuro-2a using 16717-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using ARPC5 antibody (16717-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ARPC5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16717-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

p16-ARC, p16 Arc, Arp2/3 complex 16 kDa subunit, ARC16, Actin-related protein 2/3 complex subunit 5

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, mouse thymus tissue
• Positive IHC detected in: mouse kidney tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Neuro-2a cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

16717-1-AP targets ARPC5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10144

  Product name: Recombinant human ARPC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC057237

  Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

• Full Name: actin related protein 2/3 complex, subunit 5, 16kDa
• Calculated Molecular Weight: 154 aa, 17 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC057237
• Gene Symbol: ARPC5
• Gene ID (NCBI): 10092
• RRID: AB_1850902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15511
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Mol Sci; Revealing the Therapeutic Targets and Mechanism of Ginsenoside Rg1 for Liver Damage Related to Anti-Oxidative Stress Using Proteomic Analysis; Authors - Jiying Hou
human	WB	J Neurosci; The Proteome of BLOC-1 Genetic Defects Identifies the Arp2/3 Actin Polymerization Complex to Function Downstream of the Schizophrenia Susceptibility Factor Dysbindin at the Synapse.; Authors - Avanti Gokhale
human	WB	Pigment Cell Melanoma Res; YAP facilitates melanoma migration through regulation of actin-related protein 2/3 complex subunit 5 (ARPC5); Authors - Jason W. Lui
mouse	WB	J Reprod Dev; MiR-145 regulates steroidogenesis in mouse primary granulosa cells by targeting Arpc5 and subsequent cytoskeleton remodeling; Authors - Lanfang Ma
human	IHC	BMC Cancer; ARPC5 acts as a potential prognostic biomarker that is associated with cell proliferation, migration and immune infiltrate in gliomas; Authors - Yue Ming
human	WB	Heliyon; Dapagliflozin impedes endothelial cell senescence by activating the SIRT1 signaling pathway in type 2 diabetes; Authors - Shi Tai