CoraLite® Plus 488-conjugated ARPC5 Polyclonal antibody

• 

  IF Staining of Neuro-2a using CL488-16717

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using CoraLite® Plus 488 ARPC5 antibody (CL488-16717) at dilution of 1:200.

ARPC5 Polyclonal Antibody for IF/ICC

Cat No. CL488-16717

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

ARC16, Arp2/3 complex 16 kDa subunit, ARPC5, dJ127C7.3, p16 Arc

---

Tested Applications

• Positive IF/ICC detected in: Neuro-2a cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16717 targets ARPC5 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10144

  Product name: Recombinant human ARPC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC057237

  Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

• Full Name: actin related protein 2/3 complex, subunit 5, 16kDa
• Calculated Molecular Weight: 154 aa, 17 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC057237
• Gene Symbol: ARPC5
• Gene ID (NCBI): 10092
• RRID: AB_3083989
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15511
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.