ASF1A/B Polyclonal antibody

• 

  WB analysis of mouse thymus using 11011-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 11011-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 11011-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11011-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11011-1-AP (ASF1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 11011-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11011-1-AP (ASF1A/B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 11011-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11011-1-AP (ASF1A/B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 11011-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ASF1A/B antibody (11011-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ASF1A/B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11011-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II, CIA-II

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, HeLa cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11011-1-AP targets ASF1A/B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1477

  Product name: Recombinant human ASF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC010014

  Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 202 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC010014
• Gene Symbol: ASF1B
• Gene ID (NCBI): 55723
• RRID: AB_2059670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody reacts with the ASF1B and ASF1A protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; ASF1B promotes gastric cancer progression by modulating H2AC20 and activating PI3K/AKT and ERK1/2 pathways; Authors - Mengyuan Zhao