ASF1A/B Polyclonal antibody

ASF1A/B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11011-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II, CIA-II

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse thymus tissue, HeLa cells
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

11011-1-AP targets ASF1A/B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1477

Product name: Recombinant human ASF1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-202 aa of BC010014

Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

Predict reactive species
Full Name ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
Calculated Molecular Weight 202 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC010014
Gene Symbol ASF1B
Gene ID (NCBI) 55723
RRIDAB_2059670
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NVP2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody reacts with the ASF1B and ASF1A protein.

Protocols

Product Specific Protocols
WB protocol for ASF1A/B antibody 11011-1-APDownload protocol
IHC protocol for ASF1A/B antibody 11011-1-APDownload protocol
IF protocol for ASF1A/B antibody 11011-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Pharmacol

ASF1B promotes gastric cancer progression by modulating H2AC20 and activating PI3K/AKT and ERK1/2 pathways

Authors - Mengyuan Zhao
Loading...