ASF1B Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 85848-1-RR (same clone as 85848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85848-1-RR (ASF1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85848-1-RR (same clone as 85848-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ASF1B antibody (85848-1-RR, Clone: 250195A7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 85848-1-RR (same clone as 85848-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ASF1B antibody (85848-1-RR, Clone: 250195A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 85848-1-RR (same clone as 85848-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ASF1B antibody (85848-1-RR, Clone: 250195A7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85848-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02155-2

  Cytometric bead array standard curve of MP02155-2, ASF1B-specific Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85848-3-PBS. Detection antibody: 85848-1-PBS. Standard: Ag17763. Range: 0.781-50 ng/mL.

• 

  Affinity and Kinetic Characterization of 85848-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85848-1-RR against Human ASF1B were performed. The affinity constant is 57.7 nM.

ASF1B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 85848-1-PBS

Clone No.250195A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

ASF1A/B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, CIA II, CIA-II

---

Product Information

85848-1-PBS targets ASF1B as part of a matched antibody pair:

MP02155-2: 85848-3-PBS capture and 85848-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17763

  Product name: Recombinant human ASF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-202 aa of BC010014

  Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Full Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 202 aa, 22 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC010014
• Gene Symbol: ASF1B
• Gene ID (NCBI): 55723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NVP2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody reacts with the ASF1B and ASF1A protein.