Tested Applications
Positive WB detected in | HEK-293T cells, K-562 cells |
Positive IHC detected in | human prostate cancer tissue, human gliomas tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 9 publications below |
IHC | See 9 publications below |
IF | See 5 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
26223-1-AP targets ASPM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24166 Product name: Recombinant human ASPM protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-95 aa of BC034607 Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT Predict reactive species |
Full Name | asp (abnormal spindle) homolog, microcephaly associated (Drosophila) |
Calculated Molecular Weight | 410 kDa or 218 kDa |
Observed Molecular Weight | 218 kDa |
GenBank Accession Number | BC034607 |
Gene Symbol | ASPM |
Gene ID (NCBI) | 259266 |
RRID | AB_2880431 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IZT6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ASPM antibody 26223-1-AP | Download protocol |
IHC protocol for ASPM antibody 26223-1-AP | Download protocol |
IF protocol for ASPM antibody 26223-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Aging (Albany NY) ASPM promotes glioblastoma growth by regulating G1 restriction point progression and Wnt-β-catenin signaling.
| ||
Int J Cancer Development and validation of a five-gene model to predict postoperative brain metastasis in operable lung adenocarcinoma. | ||
Front Oncol Identifying and Validating Potential Biomarkers of Early Stage Lung Adenocarcinoma Diagnosis and Prognosis. | ||
J Biol Chem The Transcription factor NF-YA is Crucial for Neural Progenitor Maintenance during Brain Development | ||
DNA Cell Biol ASPM is a Novel Candidate Gene Associated with Colorectal Cancer Cell Growth. | ||
Int J Endocrinol ASPM Promotes the Progression of Anaplastic Thyroid Carcinomas by Regulating the Wnt/β-Catenin Signaling Pathway.
|