Tested Applications
| Positive WB detected in | U2OS cells, HeLa cells, HEK-293 cells, 4T1 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 37 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
Product Information
66563-1-Ig targets ATF6 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21456 Product name: Recombinant human ATF6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC014969 Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT Predict reactive species |
| Full Name | activating transcription factor 6 |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 90-100 kDa |
| GenBank Accession Number | BC014969 |
| Gene Symbol | ATF6 |
| Gene ID (NCBI) | 22926 |
| RRID | AB_2881924 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P18850 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| IF protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| IHC protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| WB protocol for ATF6 antibody 66563-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Protein Cell POST1/C12ORF49 regulates the SREBP pathway by promoting site-1 protease maturation. | ||
J Cell Biol Antigen-derived peptides engage the ER stress sensor IRE1α to curb dendritic cell cross-presentation. | ||
Cell Rep CD44 correlates with longevity and enhances basal ATF6 activity and ER stress resistance | ||
Elife Endoplasmic reticulum stress activates human IRE1α through reversible assembly of inactive dimers into small oligomers. | ||
Mol Oncol The synthetic oleanane triterpenoid CDDO-2P-Im binds GRP78/BiP to induce unfolded protein response-mediated apoptosis in myeloma | ||
J Inflamm (Lond) Soluble epoxide hydrolase deficiency attenuates airway inflammation in COPD via IRE1α/JNK/AP-1 signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Vignesh (Verified Customer) (09-19-2025) |
|































