• Featured Product
  • KD/KO Validated

ATF6 Monoclonal antibody, PBS Only

ATF6 antibodies are primarily used to investigate endoplasmic reticulum stress and the unfolded protein response by detecting ATF6 activation in cells and tissues. Proteintech has an extensive range of ATF6 antibodies validated for WB, IHC, IF/ICC, FC (Intra), IP, ELISA and more.

Cat No. 66563-1-PBS
Clone No.3B7E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

3B7E4, activating transcription factor 6, ATF 6, ATF6 alpha, ATF6A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66563-1-PBS targets ATF6 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21456

Product name: Recombinant human ATF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC014969

Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT

Predict reactive species
Full Name activating transcription factor 6
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC014969
Gene Symbol ATF6
Gene ID (NCBI) 22926
RRIDAB_2881924
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18850
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.

Loading...
||
New chat

Able

正在加载,请稍候...