ATF7 Polyclonal antibody, PBS Only

• 

  WB analysis using 29770-1-AP (same clone as 29770-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29770-1-AP (ATF7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 29770-1-AP (same clone as 29770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29770-1-PBS in a different storage buffer formulation.

ATF7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29770-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ATFA

---

Product Information

29770-1-PBS targets ATF7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30882

  Product name: Recombinant human ATF7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-167 aa of NM_001366555

  Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL

• Full Name: activating transcription factor 7
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: NM_001366555
• Gene Symbol: ATF7
• Gene ID (NCBI): 11016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.