ATG9A Polyclonal antibody

ATG9A Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 26276-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

APG9L1, Autophagy-related protein 9A, mATG9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inhuman heart tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26276-1-AP targets ATG9A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24212

Product name: Recombinant human ATG9A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 427-528 aa of BC065534

Sequence: DQHMVFCPEQLLRVILAHIHYMPDHWQGVHFGRVAEPHCHTPHPHLLPAPTGPGDYRLLPKLHRGGRWCGRYLLLCSDGCSPAWSSPVAICWADRGLSVPAS

Predict reactive species
Full Name ATG9 autophagy related 9 homolog A (S. cerevisiae)
Calculated Molecular Weight 837 aa, 94 kDa
Observed Molecular Weight 94 kDa
GenBank Accession NumberBC065534
Gene Symbol ATG9A
Gene ID (NCBI) 79065
RRIDAB_2880457
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7Z3C6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG9A is the only transmembrane ATG protein essential for autophagy. It plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS). It has been reported that ATG9A expression is increased in oral squamous cell carcinoma and breast cancers. The inhibition of ATG9A can lead to an inhibition of cancer cell proliferation and invasion.(PMID: 29437695, 29568063). The molecular weight of ATG9A was observed at around 130 kDa in HeLa cells (PMID: 35977480).

Protocols

Product Specific Protocols
IF protocol for ATG9A antibody 26276-1-APDownload protocol
IHC protocol for ATG9A antibody 26276-1-APDownload protocol
WB protocol for ATG9A antibody 26276-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

PMID: 32727463

Authors - Cefan Zhou
ratWB

Acta Pharm Sin B

MicroRNA-34c-5p provokes isoprenaline-induced cardiac hypertrophy by modulating autophagy via targeting ATG4B.

Authors - Yuhong Zhang
mouseWB

Front Immunol

MicroRNA-34a Inhibition Alleviates Lung Injury in Cecal Ligation and Puncture Induced Septic Mice.

Authors - Song Chen
humanWB

DNA Cell Biol

Long Noncoding RNA KIF9-AS1 Regulates Transforming Growth Factor-β and Autophagy Signaling to Enhance Renal Cell Carcinoma Chemoresistance via microRNA-497-5p.

Authors - Yichen Jin
mouseWB

Mol Neurobiol

RAB7A GTPase Is Involved in Mitophagosome Formation and Autophagosome-Lysosome Fusion in N2a Cells Treated with the Prion Protein Fragment 106-126

Authors - Zhiping Li
humanIF

Autophagy

Signal-sustained imaging of mitophagy with an Enzyme-Activatable Metabolic Lipid-Labeling Probe

Authors - Xiaoxue Zou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boel (Verified Customer) (08-04-2025)

In a total protein extract from gastrocnemius muscle of a dystrophin-deficient (mdx) mouse a faint band is observed around the 100kd marker, which presumably is full lenght ATG9A. In total extract from zebrafish larvae 5dpf only a band with lower molecular weight is observed. I noticed such a band is sometimes present in ATG9A blots, however, no full lenght protein band in this fish sample.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: mouse muscle, zebrafish larvae
ATG9A Antibody Western Blot validation (1/500 dilution) in mouse muscle, zebrafish larvae (Cat no:26276-1-AP)
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells and mice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
Loading...
||
New chat Able
正在加载,请稍候...