Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human heart tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IF | See 4 publications below |
Product Information
26276-1-AP targets ATG9A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24212 Product name: Recombinant human ATG9A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 427-528 aa of BC065534 Sequence: DQHMVFCPEQLLRVILAHIHYMPDHWQGVHFGRVAEPHCHTPHPHLLPAPTGPGDYRLLPKLHRGGRWCGRYLLLCSDGCSPAWSSPVAICWADRGLSVPAS Predict reactive species |
| Full Name | ATG9 autophagy related 9 homolog A (S. cerevisiae) |
| Calculated Molecular Weight | 837 aa, 94 kDa |
| Observed Molecular Weight | 94 kDa |
| GenBank Accession Number | BC065534 |
| Gene Symbol | ATG9A |
| Gene ID (NCBI) | 79065 |
| RRID | AB_2880457 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z3C6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATG9A is the only transmembrane ATG protein essential for autophagy. It plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS). It has been reported that ATG9A expression is increased in oral squamous cell carcinoma and breast cancers. The inhibition of ATG9A can lead to an inhibition of cancer cell proliferation and invasion.(PMID: 29437695, 29568063). The molecular weight of ATG9A was observed at around 130 kDa in HeLa cells (PMID: 35977480).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATG9A antibody 26276-1-AP | Download protocol |
| IHC protocol for ATG9A antibody 26276-1-AP | Download protocol |
| WB protocol for ATG9A antibody 26276-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B MicroRNA-34c-5p provokes isoprenaline-induced cardiac hypertrophy by modulating autophagy via targeting ATG4B. | ||
EMBO Rep STING inhibits LINE-1 retrotransposition through sorting ORF1p to lysosomes for degradation | ||
Front Immunol MicroRNA-34a Inhibition Alleviates Lung Injury in Cecal Ligation and Puncture Induced Septic Mice. | ||
DNA Cell Biol Long Noncoding RNA KIF9-AS1 Regulates Transforming Growth Factor-β and Autophagy Signaling to Enhance Renal Cell Carcinoma Chemoresistance via microRNA-497-5p. | ||
Autophagy Regulation of N-Degron Recognin-Mediated Autophagy by the sars-cov-2 plpro ubiquitin deconjugase |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boel (Verified Customer) (08-04-2025) | In a total protein extract from gastrocnemius muscle of a dystrophin-deficient (mdx) mouse a faint band is observed around the 100kd marker, which presumably is full lenght ATG9A. In total extract from zebrafish larvae 5dpf only a band with lower molecular weight is observed. I noticed such a band is sometimes present in ATG9A blots, however, no full lenght protein band in this fish sample.
![]() |
FH Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue
|
FH Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells and mice tissue
|












