Anti-Human ATP1B3 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human ATP1B3 Rabbit Recombinant Antibody (98589-1-RR)

• 

  FC experiment of human peripheral blood leukocytes using 98589-1-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human ATP1B3 Rabbit RecAb (98589-1-RR, Clone:251377D4) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using 98589-1-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human ATP1B3 Rabbit RecAb (98589-1-RR, Clone:251377D4)(red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9)(blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  Affinity of 98589-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98589-1-RR against Human ATP1B3 were performed. The affinity constant is below 1 pM.

ATP1B3 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98589-1-RR

Clone No.251377D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

ATPB 3, ATPB-3, CD298, Sodium/potassium-dependent ATPase subunit beta-3, Sodium/potassium-transporting ATPase subunit beta-3

---

Tested Applications

• Positive FC detected in: FC receptor blocked human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98589-1-RR targets ATP1B3 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4947

  Product name: Recombinant Human ATP1B3 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 57-279 aa of BC011835

  Sequence: TMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

• Full Name: ATPase, Na+/K+ transporting, beta 3 polypeptide
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: BC011835
• Gene Symbol: ATP1B3
• Gene ID (NCBI): 483
• RRID: AB_3746200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54709
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

ATP1B3 (also known as CD298) is the β3 subunit of Na+/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442).