Product Information
68442-1-PBS targets ATP6 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.
Tested Reactivity | Human, Rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag31940 Product name: Recombinant human ATP6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-68 aa of YP_003024031 Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW Predict reactive species |
Full Name | ATP synthase 6; ATPase subunit 6 |
Calculated Molecular Weight | 25 kDa |
Observed Molecular Weight | 25-30 kDa |
GenBank Accession Number | YP_003024031 |
Gene Symbol | ATP6 |
Gene ID (NCBI) | 4508 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P00846 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk). F1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region.