ATP6 Monoclonal antibody, PBS Only

ATP6 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68442-1-PBS
Clone No.1H4G5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

WB, Indirect ELISA

ATP synthase subunit a, ATP6, ATPASE6, F ATPase protein 6, MT ATP6, MTATP6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68442-1-PBS targets ATP6 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31940

Product name: Recombinant human ATP6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 26-68 aa of YP_003024031

Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW

Predict reactive species
Full Name ATP synthase 6; ATPase subunit 6
Calculated Molecular Weight 25 kDa
Observed Molecular Weight25-30 kDa
GenBank Accession NumberYP_003024031
Gene Symbol ATP6
Gene ID (NCBI) 4508
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00846
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk). F1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region.

Loading...
||
New chat Able
正在加载,请稍候...