Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30334-1-AP targets ATPAF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33299 Product name: Recombinant human ATPAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 92-190 aa of BC032126 Sequence: TEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTRE Predict reactive species |
| Full Name | ATP synthase mitochondrial F1 complex assembly factor 2 |
| Calculated Molecular Weight | 289 aa, 33 kDa |
| Observed Molecular Weight | ~30 kDa |
| GenBank Accession Number | BC032126 |
| Gene Symbol | ATPAF2 |
| Gene ID (NCBI) | 91647 |
| RRID | AB_3086297 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N5M1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 30334-1-AP can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATPAF2 antibody 30334-1-AP | Download protocol |
| WB protocol for ATPAF2 antibody 30334-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



