Aconitase 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Aconitase 2 Polyclonal antibody, PBS Only (11134-1-PBS)

• 

  WB analysis using 11134-1-AP (same clone as 11134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11134-1-AP (Aconitase 2 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11134-1-AP (same clone as 11134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11134-1-AP (Aconitase 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 11134-1-AP (same clone as 11134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 11134-1-AP (Aconitase 2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11134-1-AP (same clone as 11134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11134-1-AP (Aconitase 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11134-1-AP (same clone as 11134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11134-1-AP (Aconitase 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11134-1-AP (same clone as 11134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11134-1-AP (Aconitase 2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11134-1-AP (same clone as 11134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11134-1-AP (Aconitase 2 antibody) at dilution of 1:50 (under 25x lens). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11134-1-AP (same clone as 11134-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Aconitase 2 antibody (11134-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 11134-1-PBS in a different storage buffer formulation.

Aconitase 2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ACO2, ACO 2, Aconitase, Aconitase2, Citrate hydro-lyase

---

Product Information

11134-1-PBS targets Aconitase 2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1590

  Product name: Recombinant human ACO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-306 aa of BC014092

  Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

• Full Name: aconitase 2, mitochondrial
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC014092
• Gene Symbol: ACO2
• Gene ID (NCBI): 50
• RRID: AB_2289288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).