Aggrecan Polyclonal antibody

• 

  IHC staining of human lung cancer using 30532-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30532-1-AP (Aggrecan antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 30532-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30532-1-AP (Aggrecan antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of ATDC-5 using 30532-1-AP

  1x10^6 ATDC-5 cells were intracellularly stained with 0.25 ug Aggrecan Polyclonal Antibody (30532-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Aggrecan Polyclonal Antibody for IHC, ELISA

Cat No. 30532-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

ACAN, AGC1, AGCAN, Aggrecan 1, Aggrecan core protein 2

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: ATDC-5 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30532-1-AP targets Aggrecan in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32723

  Product name: Recombinant human ACAN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC036445

  Sequence: MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGI

• Full Name: aggrecan
• Calculated Molecular Weight: 250 kDa
• GenBank Accession Number: BC036445
• Gene Symbol: ACAN
• Gene ID (NCBI): 176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16112
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aggrecan (ACAN), also named as CSPCP, AGC1 and MSK16, belongs to the aggrecan/versican proteoglycan family (also including versican, brevican and neurocan). It is a major component of extracellular matrix of cartilaginous tissues. A major function of aggrecan is to resist compression in cartilage. It binds avidly to hyaluronic acid via an N-terminal globular region.