Anti-Human Alpha Synuclein Rabbit Recombinant Antibody

• 

  IHC staining of Human brain cancer（Astrocitoma） using 98708-2-RR

  Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 98708-2-RR (Alpha Synuclein antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of Human brain cancer（Astrocitoma） using 98708-2-RR

  Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 98708-2-RR (Alpha Synuclein antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of SH-SY5Y using 98708-2-RR

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug Anti-Human Alpha Synuclein Rabbit RecAb (98708-2-RR, Clone:251410F3)(red),or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  Affinity and Kinetic Characterization of 98708-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98708-2-RR against Human Alpha Synuclein were performed. The affinity constant is 4.82 nM.

Alpha Synuclein Uni-rAb^® Recombinant Antibody for IHC, FC (Intra)

Cat No. 98708-2-RR

Clone No.251410F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC (Intra)

Synonyms

1, a-synuclein, SNCA, alpha syn, alpha-syn

---

Tested Applications

• Positive IHC detected in: Human brain cancer（Astrocitoma）; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98708-2-RR targets Alpha Synuclein in IHC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5390

  Product name: Recombinant human SNCA protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-140 aa of BC108275

  Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

• Full Name: synuclein, alpha (non A4 component of amyloid precursor)
• GenBank Accession Number: BC108275
• Gene Symbol: Alpha Synuclein
• Gene ID (NCBI): 6622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37840
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.