Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-82296-6 targets Aquaporin 4 in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Full Name | Aquaporin 4 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| Observed Molecular Weight | 32-34 kDa |
| GenBank Accession Number | BC022286 |
| Gene Symbol | Aquaporin 4 |
| Gene ID (NCBI) | 361 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55087 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.



