CoraLite®594-conjugated Aquaporin 4 Recombinant monoclonal antibody

Aquaporin 4 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL594-82296-6
Clone No.240856C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

AQP4, 240856C7, AQP 4, AQP-4, Aquaporin4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-82296-6 targets Aquaporin 4 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9561

Product name: Recombinant human AQP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 208-323 aa of BC022286

Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Predict reactive species
Full Name Aquaporin 4
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight 32-34 kDa
GenBank Accession NumberBC022286
Gene Symbol Aquaporin 4
Gene ID (NCBI) 361
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55087
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.

Loading...
||
New chat Able
正在加载,请稍候...