• Featured Product
  • KD/KO Validated

Arp5/ACTR5 Monoclonal antibody, PBS Only (Capture)

Arp5/ACTR5 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67326-1-PBS
Clone No.1E11C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

ACTR5, ARP5, 1E11C1, Actin related protein 5, Actin-related protein 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67326-1-PBS targets Arp5/ACTR5 as part of a matched antibody pair:

MP51677-1: 67326-1-PBS capture and 67326-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15976

Product name: Recombinant human ACTR5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 258-607 aa of BC038402

Sequence: EELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERLQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGGGGAGEQA

Predict reactive species
Full Name ARP5 actin-related protein 5 homolog (yeast)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC038402
Gene Symbol ARP5/ACTR5
Gene ID (NCBI) 79913
RRIDAB_2882585
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H9F9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Arp5 is a member of nuclear actin-related proteins (ARPs) that function as components of the chromatin- remodeling complex. Recently study reported that Arp5 regulates smooth muscle cell differentiation through interaction with myocardin (Myocd). Arp5 has been identified as negative regulator of Myocd, suppressing Myocd activity in the nucleus through tightly binding with Myocd RPEL motifs. Alternative splicing results in two variants of Arp5: a broadly expressed arp5-common, and a smooth muscle restricted arp5-sm. Expression of Arp5-sm protein is strongly suppressed in well-differentiated smooth muscle cells by partial messenger RNA decay and translational suppression. (24567363)

Loading...
||
New chat

Able

正在加载,请稍候...