Mouse ATP1B1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 85916-1-RR (same clone as 85916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85916-1-RR (Atp1b1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85916-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85916-1-RR (same clone as 85916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85916-1-RR (Atp1b1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85916-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP02193-3

  Sandwich ELISA standard curve of MP02193-3, Mouse ATP1B1 Recombinant Matched Antibody Pair - PBS only. 85916-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3007. 85916-1-PBS was HRP conjugated as the detection antibody. Range: 46.9-3000 pg/mL.

• 

  Sample test of MP02193-3

  The mean ATP1B1 concentration was determined to be 58,169.6 pg/mL in mouse heart extract based on a 6.9 mg/mL extract load.

• 

  IHC staining of mouse liver using 85916-1-RR (same clone as 85916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85916-1-RR (ATP1B1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85916-1-RR (same clone as 85916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85916-1-RR (ATP1B1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85916-1-PBS in a different storage buffer formulation.

ATP1B1 Uni-rAb^® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85916-1-PBS

Clone No.243093E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

ATP1B 1, Atp4b, Beta 1 subunit of Na(+) K(+) ATPase, Na, K-ATPase β1, Na+/K+ ATPase beta 1 subunit

---

Product Information

85916-1-PBS targets ATP1B1 as part of a matched antibody pair:

MP02193-3: 85916-2-PBS capture and 85916-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3007

  Product name: Recombinant Mouse Atp1b1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 63-304 aa of NM_009721.6

  Sequence: ELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

• Full Name: ATPase, Na+/K+ transporting, beta 1 polypeptide
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: NM_009721.6
• Gene Symbol: Atp1b1
• Gene ID (NCBI): 11931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14094
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)