ATP1B1 Recombinant monoclonal antibody

• 

  WB analysis using 85916-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85916-1-RR (Atp1b1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85916-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85916-1-RR (Atp1b1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 85916-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85916-1-RR (ATP1B1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 85916-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85916-1-RR (ATP1B1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATP1B1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85916-1-RR

Clone No.243093E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ATP1B 1, Atp4b, Beta 1 subunit of Na(+) K(+) ATPase, Na, K-ATPase β1, Na+/K+ ATPase beta 1 subunit

---

Tested Applications

• Positive WB detected in: mouse brain tissue, fetal human brain tissue, mouse heart tissue, rat heart tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85916-1-RR targets ATP1B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3007

  Product name: Recombinant Mouse Atp1b1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 63-304 aa of NM_009721.6

  Sequence: ELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

• Full Name: ATPase, Na+/K+ transporting, beta 1 polypeptide
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: NM_009721.6
• Gene Symbol: Atp1b1
• Gene ID (NCBI): 11931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14094
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)