BAF53B Polyclonal antibody, PBS Only

BAF53B Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 27215-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

ACTL6B, 53 kDa BRG1-associated factor B, actin like 6B, Actin like protein 6B, Actin related protein Baf53b

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

27215-1-PBS targets BAF53B in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25745

Product name: Recombinant human ACTL6B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 40-82 aa of BC020944

Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM

Predict reactive species
Full Name actin-like 6B
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47-53 kDa
GenBank Accession NumberBC020944
Gene Symbol BAF53B
Gene ID (NCBI) 51412
RRIDAB_2857952
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94805
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BAF53B, also named as ACTL6B, encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. BAF53b is unique among nucleosome remodeling complex subunits because it is neuron specific and is not found in any other nucleosome remodeling complex besides the nBAF complex(PMID: 23525042). BAF53B can be detected as about 47-53 kDa.

Loading...
||
New chat Able
正在加载,请稍候...