Product Information
27215-1-PBS targets BAF53B in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25745 Product name: Recombinant human ACTL6B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-82 aa of BC020944 Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM Predict reactive species |
| Full Name | actin-like 6B |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 47-53 kDa |
| GenBank Accession Number | BC020944 |
| Gene Symbol | BAF53B |
| Gene ID (NCBI) | 51412 |
| RRID | AB_2857952 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94805 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
BAF53B, also named as ACTL6B, encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. BAF53b is unique among nucleosome remodeling complex subunits because it is neuron specific and is not found in any other nucleosome remodeling complex besides the nBAF complex(PMID: 23525042). BAF53B can be detected as about 47-53 kDa.







