• Featured Product
  • KD/KO Validated

BAX Polyclonal antibody

The BAX polyclonal antibody (50599-2-Ig) is the highest cited BAX antibody in the market with 4,226 citations.

Cat No. 50599-2-Ig
Publications(4226)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IP, CoIP, ELISA

Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HT-1080 cells, PC-12 cells, NIH/3T3 cells, Raji cells, mouse kidney tissue, rat kidney tissue, rat colon tissue, rat lung tissue, BALB/3T3 clone A31, RAW 264.7 cells, rat brain tissue, mouse heart tissue
Positive IP detected inRaji cells, mouse heart tissue
Positive IHC detected inmouse lung tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

50599-2-Ig targets BAX in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, monkey, chicken, zebrafish, hamster, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0576

Product name: Recombinant human BAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC014175

Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predict reactive species
Full Name BCL2-associated X protein
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC014175
Gene Symbol BAX
Gene ID (NCBI) 581
RRIDAB_2061561
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07812
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAX (also known as BCL2 Associated X, Bcl-2-Like Protein 4, Bcl2-L-4, BCL2L4) is a member of the BCL2 family of proteins that play a key role in the regulation of apoptosis in higher eukaryotes (https://www.uniprot.org/uniprot/Q07812). BAX comprises 4 Bcl-2 homology domains (BH1-BH4) and a C-terminal transmembrane domain. In healthy mammalian cells, BAX is localized to the cytoplasm through its interaction with the anti-apoptotic BL-2 family members BCL2L1/Bcl-xL (PMIDs: 28755482, 21458670). In response to apoptotic stimuli, however, BAX undergoes a conformational change that causes it to translocate to the outer mitochondrial membrane where it initiates the mitochondrial pathway of apoptosis via two potential mechanisms. Firstly, upon translocation to the outer mitochondrial membrane, BAX interacts with the mitochondrial voltage-dependent anion channel (VDAC) leading to the opening of the channel, loss of membrane potential, and the release of cytochrome c from the mitochondrion (PMID:10766872). The release of cytochrome C into the cytoplasm leads to the activation of Caspase3, initiating apoptosis. Secondly, activated BAX forms homodimers, which then assemble into oligomers on the mitochondrial outer membrane to create pores that permeabilize the mitochondrion leading to the release of cytochrome C (PMID:25458844).

BAX has been shown to be involved in p53-mediated apoptosis. Expression of the human bax gene has been shown to be directly regulated by p53, and the bax promoter contains four motifs with homology to consensus p53-binding sites (PMID:7834749). Furthermore, p53 directly interacts with BAX to promote its activation (PMID:14963330).

What is the molecular weight of BAX?

BAX is a 192 amino acid protein that has a predicted molecular weight of 21.1 kDa.

What is the subcellular localization of BAX?

In healthy mammalian cells, BAX is localized to the cytoplasm. In response to apoptotic stimuli, BAX translocates to the outer mitochondrial membrane.

 What is the tissue specificity of BAX?

BAX is ubiquitously expressed (PMID: 25613900).

What is the connection between BAX and cancer?

BAX appears to play an important role in suppressing cancer development, and decreased BAX levels are associated with chemo- and radioresistance in a number of cancers including lung cancer, chronic lymphocytic leukemia (CLL), and prostate cancer. Loss-of-function mutations of BAX have also been reported in hematopoietic malignancies in humans (PMID:9531611) and in gastrointestinal cancer of the microsatellite mutator phenotype (MMP), where BAX inactivation contributes to tumor progression by providing a survival advantage (PMID:9331106).

A number of anticancer drugs used clinically have been demonstrated to induce BAX activation indirectly to facilitate apoptosis of tumor cells. Recent efforts have demonstrated that BAX itself may be a promising direct target for small-molecule drug discovery for novel anticancer drugs and several direct BAX activators have been identified that may hold promise for cancer therapy, with the potential to overcome chemo- and radioresistance (PMID:25230299).


Protocols

Product Specific Protocols
IF protocol for BAX antibody 50599-2-IgDownload protocol
IHC protocol for BAX antibody 50599-2-IgDownload protocol
IP protocol for BAX antibody 50599-2-IgDownload protocol
WB protocol for BAX antibody 50599-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

The Cytoplasmic DNA Sensor cGAS Promotes Mitotic Cell Death.

Authors - Christian Zierhut
mouseWB

Bioact Mater

Chemo-immunotherapy by dual-enzyme responsive peptide self-assembling abolish melanoma

Authors - Yuhan Wang
mouseWB

ACS Nano

Nanointegrative In Situ Reprogramming of Tumor-Intrinsic Lipid Droplet Biogenesis for Low-Dose Radiation-Activated Ferroptosis Immunotherapy

Authors - Qiqi Zhang

ACS Nano

Melatonin-Derived Carbon Dots with Free Radical Scavenging Property for Effective Periodontitis Treatment via the Nrf2/HO-1 Pathway

Authors - Xirui Xin
humanWB

Mol Cell

Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.

Authors - Bin Jiang
  • KO Validated
humanWB

Cell Death Differ

TRIM32 promotes anoikis resistance and metastasis in NSCLC by degrading CHEK2 to enhance IL-6 secretion

Authors - Jia Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sai Sindhura (Verified Customer) (01-08-2026)

BAX antibody worked very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
FH

Mounika (Verified Customer) (01-08-2026)

Wonderful antibodies , bright bands!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
FH

Charlotte (Verified Customer) (08-15-2024)

Intense band at the expected MW

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: NIH-3T3
BAX Antibody Western Blot validation (1/5000 dilution) in NIH-3T3 (Cat no:50599-2-Ig)
FH

Macarena Lucia (Verified Customer) (10-17-2022)

nice band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

ZEE (Verified Customer) (07-13-2020)

VERY GOOD antibody when western

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MOUSE HEART
FH

Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
FH

Kathryn (Verified Customer) (11-04-2019)

Image shows a post-natal day 2 mouse ovary with germ cells marked by TRA98 (Abcam) in green, and BAX (Proteintech) marked in red.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: mouse ovary
BAX Antibody Immunofluorescence, validation (1:100 dilution) in mouse ovary (Cat no:50599-2-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...