BCLAF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67860-1-Ig (same clone as 67860-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67860-1-Ig (BCLAF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67860-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67860-1-Ig (same clone as 67860-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67860-1-Ig (BCLAF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67860-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67860-1-Ig (same clone as 67860-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67860-1-Ig (BCLAF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67860-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67860-1-Ig (same clone as 67860-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BCLAF1 antibody (67860-1-Ig, Clone: 1D6G7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 67860-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 67860-1-Ig (same clone as 67860-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.5 ug Anti-Human BCLAF1 (67860-1-Ig, Clone:1D6G7) (red) labeled with FlexAble CoraLite® Plus 555 Antibody Labeling Kit for Mouse IgG1 (KFA022), or 0.5 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67860-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BCLAF1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67860-1-PBS

Clone No.1D6G7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

KIAA0164, Btf, BCLAF1 and THRAP3 family member 1, Bcl-2-associated transcription factor 1, 1D6G7

---

Product Information

67860-1-PBS targets BCLAF1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25210

  Product name: Recombinant human BCLAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-920 aa of BC132780

  Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE

• Full Name: BCL2-associated transcription factor 1
• Calculated Molecular Weight: 920 aa, 106 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132780
• Gene Symbol: BCLAF1
• Gene ID (NCBI): 9774
• RRID: AB_2918618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NYF8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.