Tested Applications
Positive WB detected in | A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
67860-1-Ig targets BCLAF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species |
Full Name | BCL2-associated transcription factor 1 |
Calculated Molecular Weight | 920 aa, 106 kDa |
Observed Molecular Weight | 145 kDa |
GenBank Accession Number | BC132780 |
Gene Symbol | BCLAF1 |
Gene ID (NCBI) | 9774 |
RRID | AB_2918618 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NYF8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BCLAF1 antibody 67860-1-Ig | Download protocol |
IHC protocol for BCLAF1 antibody 67860-1-Ig | Download protocol |
IF protocol for BCLAF1 antibody 67860-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy Epg5 deficiency leads to primary ovarian insufficiency due to WT1 accumulation in mouse granulosa cells. | ||
Cell Mol Life Sci BCLAF1 binds SPOP to stabilize PD-L1 and promotes the development and immune escape of hepatocellular carcinoma
|