BCRP/ABCG2 Recombinant monoclonal antibody

• 

  WB analysis using 83835-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83835-1-RR (BCRP,ABCG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 83835-1-RR

  WB result of BCRP/ABCG2 antibody (83835-1-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCRP/ABCG2 transfected HEK-293 cells.

• 

  Affinity and Kinetic Characterization of 83835-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83835-1-RR against Human BCRP,ABCG2 were performed. The affinity constant is 9.85 nM.

• Featured Product
• KD/KO Validated

BCRP/ABCG2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83835-1-RR

Clone No.240959A4

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

ABCG2, BCRP, BCRP,ABCG2, 240959A4, ABC15

---

Tested Applications

• Positive WB detected in: HEK-293 cells, U-251 cells, MCF-7 cells, SGC-7901 cells, HepG2 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

83835-1-RR targets BCRP/ABCG2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25911

  Product name: Recombinant human BCRP,ABCG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 557-630 aa of BC021281

  Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 2
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC021281
• Gene Symbol: ABCG2
• Gene ID (NCBI): 9429
• RRID: AB_3671417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Food Funct; Multi-strategy profiling identifies limonin's dual role in gout: restoring uric acid homeostasis and suppressing inflammatory response.; Authors - Minjie Zeng
human	WB	Phytomedicine; The chemosensitizing activity of betulinic acid in suppressing macrophage polarization through GSK-3β/β-catenin/CXCL1 signaling in breast cancer.; Authors - Zheng Xu
mouse	WB	J Ethnopharmacol; The mechanism of honeysuckle peptides in ameliorating hyperuricemia in mice via the PGC-1α/PPARγ/ABCG2 pathway.; Authors - Hongxuan Yang