• Featured Product
  • KD/KO Validated

BCRP/ABCG2 Recombinant monoclonal antibody, PBS Only (Capture)

BCRP/ABCG2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83835-1-PBS
Clone No.240959A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

ABCG2, BCRP, BCRP,ABCG2, 240959A4, ABC15

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83835-1-PBS targets BCRP/ABCG2 as part of a matched antibody pair:

MP00805-1: 83835-1-PBS capture and 83835-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25911

Product name: Recombinant human BCRP,ABCG2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 557-630 aa of BC021281

Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH

Predict reactive species
Full Name ATP-binding cassette, sub-family G (WHITE), member 2
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 68-72 kDa
GenBank Accession NumberBC021281
Gene Symbol ABCG2
Gene ID (NCBI) 9429
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UNQ0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.

Loading...
||
New chat Able
正在加载,请稍候...