BDKRB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BDKRB1 Polyclonal antibody (26672-1-AP)

BDKRB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26672-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

B1 bradykinin receptor, B1BKR, B1R, BDKRB1, BK 1 receptor, BKB1R, BKR1, BRADYB1, bradykinin receptor B1

• 

  WB analysis of HUVEC using 26672-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 26672-1-AP (BDKRB1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26672-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26672-1-AP (BDKRB1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26672-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26672-1-AP (BDKRB1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 26672-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 26672-1-AP (BDKRB1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 26672-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 26672-1-AP (BDKRB1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BDKRB1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells
• Positive IHC detected in: human kidney tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26672-1-AP targets BDKRB1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24745

  Product name: Recombinant human BDKRB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 94-154 aa of BC034705

  Sequence: AENIWNQFNWPFGALLCRVINGVIKANLFISIFLVVAISQDRYRVLVHPMASRRQQRRRQA

• Full Name: bradykinin receptor B1
• Calculated Molecular Weight: 353 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC034705
• Gene Symbol: BDKRB1
• Gene ID (NCBI): 623
• RRID: AB_2880596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46663
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BDKRB1 Polyclonal antibody (Cat# 26672-1-AP) has 3 citations published in Advanced Science, Pharmaceuticals, and Frontiers in Endocrinology. The associated research fields include colorectal tumorigenesis and fibroblast phenotypic transition, bradykinin B1 receptor detection in glioblastoma xenograft models, and the role of the bradykinin system in prostaglandin-endoperoxide synthase 2 expression in human amnion fibroblasts with implications for term and preterm birth.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Sci (Weinh); KLK1 as an Epithelial-Specific Brake Inhibits Colorectal Tumorigenesis by Suppressing B1R-Mediated Fibroblast Phenotypic Transition; Authors - Lisha Zhou
human	WB	Pharmaceuticals (Basel); Assessment of Radiolabelled Derivatives of R954 for Detection of Bradykinin B1 Receptor in Cancer Cells: Studies on Glioblastoma Xenografts in Mice; Authors - Miho Shukuri
human	IHC	Front Endocrinol (Lausanne); The Bradykinin System Contributes to the Regulation osungangrenji@hotmail.comf Prostaglandin-Endoperoxide Synthase 2 Expression in Human Amnion Fibroblasts: Implications for Term and Preterm Birth.; Authors - Xiao-Tian Ni