Tested Applications
Positive WB detected in | HUVEC cells |
Positive IHC detected in | human kidney tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
26672-1-AP targets BDKRB1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24745 Product name: Recombinant human BDKRB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 94-154 aa of BC034705 Sequence: AENIWNQFNWPFGALLCRVINGVIKANLFISIFLVVAISQDRYRVLVHPMASRRQQRRRQA Predict reactive species |
Full Name | bradykinin receptor B1 |
Calculated Molecular Weight | 353 aa, 40 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC034705 |
Gene Symbol | BDKRB1 |
Gene ID (NCBI) | 623 |
RRID | AB_2880596 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P46663 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BDKRB1 antibody 26672-1-AP | Download protocol |
IHC protocol for BDKRB1 antibody 26672-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Endocrinol (Lausanne) The Bradykinin System Contributes to the Regulation osungangrenji@hotmail.comf Prostaglandin-Endoperoxide Synthase 2 Expression in Human Amnion Fibroblasts: Implications for Term and Preterm Birth. | ||
Pharmaceuticals (Basel) Assessment of Radiolabelled Derivatives of R954 for Detection of Bradykinin B1 Receptor in Cancer Cells: Studies on Glioblastoma Xenografts in Mice | ||
Adv Sci (Weinh) KLK1 as an Epithelial-Specific Brake Inhibits Colorectal Tumorigenesis by Suppressing B1R-Mediated Fibroblast Phenotypic Transition |