Tested Applications
| Positive WB detected in | human brain tissue |
| Positive IHC detected in | human medulloblastoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
12390-1-AP targets BEX1/2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3066 Product name: Recombinant human BEX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC015522 Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP Predict reactive species |
| Full Name | brain expressed X-linked 2 |
| Calculated Molecular Weight | 128 aa, 15 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC015522 |
| Gene Symbol | BEX2 |
| Gene ID (NCBI) | 84707 |
| RRID | AB_10644326 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXY8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BEX1 is a signaling adapter molecule involved in p75NTR/NGFR signaling. It lays a role in cell cycle progression and neuronal differentiation. BEX1 inhibits neuronal differentiation in response to nerve growth factor (NGF). BEX2 is a regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. It regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. The homology between human BEX1 and BEX2 is 94%. This antibody detects both BEX1 and BEX2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BEX1/2 antibody 12390-1-AP | Download protocol |
| WB protocol for BEX1/2 antibody 12390-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
BMC Biol Bex1 is essential for ciliogenesis and harbours biomolecular condensate-forming capacity. | ||
Front Cell Dev Biol Single-cell and genetic multi-omics analysis combined with experiments confirmed the signature and potential targets of cuproptosis in hepatocellular carcinoma | ||
Cell Death Dis Crotonylated BEX2 interacts with NDP52 and enhances mitophagy to modulate chemotherapeutic agent-induced apoptosis in non-small-cell lung cancer cells | ||
Aging (Albany NY) Machine learning-based identification and immune characterization of ferroptosis-related molecular clusters in osteoarthritis and validation | ||
Transl Oncol LMO2 confers value as a potential immunotherapy marker in pan-cancer analysis and inhibits progression of Clear Cell Renal Cell Carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kamal (Verified Customer) (02-15-2024) | This antibody works for mouse liver tissue when diluted in 1X TBST.
|



