BEX1/2 Polyclonal antibody

BEX1/2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 12390-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

BEX1, BEX1/2, BEX2, brain expressed X linked 2, hBex2, Protein BEX2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue
Positive IHC detected inhuman medulloblastoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12390-1-AP targets BEX1/2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3066

Product name: Recombinant human BEX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-128 aa of BC015522

Sequence: MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

Predict reactive species
Full Name brain expressed X-linked 2
Calculated Molecular Weight 128 aa, 15 kDa
Observed Molecular Weight 10-15 kDa
GenBank Accession NumberBC015522
Gene Symbol BEX2
Gene ID (NCBI) 84707
RRIDAB_10644326
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BXY8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BEX1 is a signaling adapter molecule involved in p75NTR/NGFR signaling. It lays a role in cell cycle progression and neuronal differentiation. BEX1 inhibits neuronal differentiation in response to nerve growth factor (NGF). BEX2 is a regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. It regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. The homology between human BEX1 and BEX2 is 94%. This antibody detects both BEX1 and BEX2.

Protocols

Product Specific Protocols
IHC protocol for BEX1/2 antibody 12390-1-APDownload protocol
WB protocol for BEX1/2 antibody 12390-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseIF

BMC Biol

Bex1 is essential for ciliogenesis and harbours biomolecular condensate-forming capacity.

Authors - Emi Hibino
humanWB

Int J Biol Sci

BEX2 promotes tumor proliferation in colorectal cancer.

Authors - Yeting Hu
humanWB

Front Cell Dev Biol

Single-cell and genetic multi-omics analysis combined with experiments confirmed the signature and potential targets of cuproptosis in hepatocellular carcinoma

Authors - Feng Cao
human,mouseIHC,IF

Cell Death Dis

Crotonylated BEX2 interacts with NDP52 and enhances mitophagy to modulate chemotherapeutic agent-induced apoptosis in non-small-cell lung cancer cells

Authors - Ning Mu
humanWB

Aging (Albany NY)

Machine learning-based identification and immune characterization of ferroptosis-related molecular clusters in osteoarthritis and validation

Authors - Xiaocheng Guo
humanWB

Transl Oncol

LMO2 confers value as a potential immunotherapy marker in pan-cancer analysis and inhibits progression of Clear Cell Renal Cell Carcinoma

Authors - Huiping Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (02-15-2024)

This antibody works for mouse liver tissue when diluted in 1X TBST.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse liver tissue
Loading...
||
New chat Able
正在加载,请稍候...