HRP-conjugated BID Monoclonal antibody

• 

  WB analysis of Jurkat using HRP-60301

  Jurkat cells were subjected to SDS PAGE followed by western blot with HRP-60301 (BID antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

BID Monoclonal Antibody for WB

Cat No. HRP-60301

Clone No.2A2E5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB

Synonyms

BID, FP497, p11 BID, p22 BID

---

Tested Applications

• Positive WB detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

HRP-60301 targets BID in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21005

  Product name: Recombinant human BID protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-195 aa of BC009197

  Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

• Full Name: BH3 interacting domain death agonist
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC009197
• Gene Symbol: BID
• Gene ID (NCBI): 637
• RRID: AB_2883832
• Conjugate: HRP
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P55957
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BID, also named as p22 BID, can be cleaved into p11 BID, p13 BID and p15 BID. It is pro-apoptotic molecules. The major proteolytic product p15 BID allows the release of cytochrome c. BID-L, BID-EL and BID-ES induce ICE-like proteases and apoptosis. BID-S does not induce apoptosis. BID counters the protective effect of Bcl-2. (PMID:14583606).