BMI1 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of PC-12 using 66161-1-Ig (same clone as 66161-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 66161-1-Ig (BMI1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 66161-1-Ig (same clone as 66161-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 66161-1-Ig (BMI1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 66161-1-Ig (same clone as 66161-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 66161-1-Ig (BMI1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 66161-1-Ig (same clone as 66161-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 66161-1-Ig (BMI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 66161-1-Ig (same clone as 66161-1-PBS)

  IP result of anti-BMI1 (IP:66161-1-Ig, 3ug; Detection:66161-1-Ig 1:1000) with HEK-293 cells lysate 1800ug. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66161-1-Ig (BMI1 Antibody) at dilution of 1:50 under 40x lens. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66161-1-Ig (BMI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 66161-1-Ig (BMI1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66161-1-Ig (BMI1 Antibody) at dilution of 1:50 under 10x lens. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IF Staining of COS-7 using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunofluorescent analysis of COS-7 cells using 66161-1-Ig (BMI1 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Mouse IgG. This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66161-1-Ig (same clone as 66161-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using BMI1 antibody (66161-1-Ig, Clone: 2E10A11 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66161-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51443-1

  Cytometric bead array sample test of MP51443-1, BMI1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66161-2-PBS. Detection antibody: 66161-1-PBS.

• 

  Cytometric bead array standard curve of MP51443-1

  Cytometric bead array standard curve of MP51443-1, BMI1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66161-2-PBS. Detection antibody: 66161-1-PBS. Standard:Ag21284. Range: 0.391-100 ng/mL.

• Featured Product
• KD/KO Validated

BMI1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Cat No. 66161-1-PBS

Clone No.2E10A11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, monkey

Applications

WB, IHC, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Synonyms

2E10A11, PCGF4, Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RNF51

---

Product Information

66161-1-PBS targets BMI1 as part of a matched antibody pair:

MP51443-1: 66161-2-PBS capture and 66161-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21284

  Product name: Recombinant human BMI1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-326 aa of BC011652

  Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

• Full Name: BMI1 polycomb ring finger oncogene
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-43 kDa
• GenBank Accession Number: BC011652
• Gene Symbol: BMI1
• Gene ID (NCBI): 648
• RRID: AB_2881557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35226
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody reacts with the 37kd BMI1 protein.