• Featured Product
  • KD/KO Validated

BMI1 Monoclonal antibody, PBS Only (Detector)

BMI1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 66161-1-PBS
Clone No.2E10A11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, monkey

Applications

WB, IHC, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

2E10A11, PCGF4, Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RNF51

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66161-1-PBS targets BMI1 as part of a matched antibody pair:

MP51443-1: 66161-2-PBS capture and 66161-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, monkey
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21284

Product name: Recombinant human BMI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-326 aa of BC011652

Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Predict reactive species
Full Name BMI1 polycomb ring finger oncogene
Calculated Molecular Weight 37 kDa
Observed Molecular Weight37-43 kDa
GenBank Accession NumberBC011652
Gene Symbol BMI1
Gene ID (NCBI) 648
RRIDAB_2881557
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35226
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody reacts with the 37kd BMI1 protein.

Loading...
||
New chat

Able

正在加载,请稍候...