BMP5 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 13253-1-AP (same clone as 13253-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 13253-1-AP (same clone as 13253-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 13253-1-AP (same clone as 13253-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13253-1-AP (same clone as 13253-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13253-1-AP (same clone as 13253-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13253-1-AP (same clone as 13253-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13253-1-AP (same clone as 13253-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13253-1-PBS in a different storage buffer formulation.

BMP5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13253-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

BMP 5, BMP-5, Bone morphogenetic protein 5

---

Product Information

13253-1-PBS targets BMP5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3952

  Product name: Recombinant human BMP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-348 aa of BC027958

  Sequence: GLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSE

• Full Name: bone morphogenetic protein 5
• Calculated Molecular Weight: 454 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC027958
• Gene Symbol: BMP5
• Gene ID (NCBI): 653
• RRID: AB_2877929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22003
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.