BMP5 Polyclonal antibody

• 

  WB analysis of mouse lung using 13253-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13253-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 13253-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 13253-1-AP (BMP5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 13253-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 13253-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 13253-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 13253-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13253-1-AP (BMP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BMP5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13253-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

BMP 5, BMP5, BMP-5, bone morphogenetic protein 5

---

Tested Applications

• Positive WB detected in: mouse lung tissue, HUVEC cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

13253-1-AP targets BMP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3952

  Product name: Recombinant human BMP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-348 aa of BC027958

  Sequence: GLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSE

• Full Name: bone morphogenetic protein 5
• Calculated Molecular Weight: 454 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC027958
• Gene Symbol: BMP5
• Gene ID (NCBI): 653
• RRID: AB_2877929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22003
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; G9a Knockdown Suppresses Cancer Aggressiveness by Facilitating Smad Protein Phosphorylation through Increasing BMP5 Expression in Luminal A Type Breast Cancer.; Authors - Yunho Jin
human	WB	FASEB J; Pilocarpine mediated excessive calcium accumulation leads to ciliary muscle cell senescence and apoptosis; Authors - Xiang Gao
human	WB	Placenta; BMP5 promotes trophoblast functions upon N-glycosylation via the BMP5-SMAD1/5 signaling pathway in preeclampsia; Authors - Hao Wang
	WB	Phytomedicine; Lutein protects senescent ciliary muscle against oxidative stress through the Keap1/Nrf2/ARE pathway; Authors - Ning Gao
human	IHC	Mol Cancer; Alteration of tumor suppressor BMP5 in sporadic colorectal cancer: a genomic and transcriptomic profiling based study.; Authors - Erfei Chen