BMPR2 Polyclonal antibody

• 

  WB analysis of human heart using 19087-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 19087-1-AP (BMPR2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 19087-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 19087-1-AP (BMPR2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 19087-1-AP

  IP result of anti-BMPR2 (IP:19087-1-AP, 4ug; Detection:19087-1-AP 1:1500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human heart using 19087-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 19087-1-AP (BMPR2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 19087-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 19087-1-AP (BMPR2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of PC-3 using 19087-1-AP

  1x10^6 PC-3 cells were intracellularly stained with 0.4 ug BMPR2 Polyclonal antibody (19087-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

BMPR2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 19087-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

BMPR-2, BMPR II, BMPR 2, BMP type-2 receptor, BMP type II receptor

---

Tested Applications

• Positive WB detected in: human heart tissue, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IF: See 2 publications below

Product Information

19087-1-AP targets BMPR2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5868

  Product name: Recombinant human BMPR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 172-504 aa of BC052985

  Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL

• Full Name: bone morphogenetic protein receptor, type II (serine/threonine kinase)
• Calculated Molecular Weight: 115 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC052985
• Gene Symbol: BMPR2
• Gene ID (NCBI): 659
• RRID: AB_10603355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13873
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. The dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form, and 150 kD dimer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Theranostics; Polycomb repressive complex 1 modulates granulosa cell proliferation in early folliculogenesis to support female reproduction; Authors - Meng Gao
rat	WB,IF	Basic Res Cardiol; The miR-182/Myadm axis regulates hypoxia-induced pulmonary hypertension by balancing the BMP- and TGF-β-signalling pathways in an SMC/EC-crosstalk-associated manner; Authors - Yongyi Bai
human		J Cell Biol; A PINCH-1-Smurf1 signaling axis mediates mechano-regulation of BMPR2 and stem cell differentiation.; Authors - Ling Guo
		Sci Signal; Augmented noncanonical BMP type II receptor signaling mediates the synaptic abnormality of fragile X syndrome.; Authors - Risa Kashima
mouse	WB	Am J Physiol Lung Cell Mol Physiol; Transforming growth factor-β plays divergent roles in modulating vascular remodeling, inflammation, and pulmonary fibrosis in a murine model of scleroderma; Authors - Kazuyuki Tsujino
mouse	WB	Commun Biol; Bone morphogenetic protein signaling is required for RAD51-mediated maintenance of genome integrity in vascular endothelial cells.; Authors - Sanna Vattulainen-Collanus ; KD Validated