• Featured Product
  • KD/KO Validated

BMPR2 Polyclonal antibody

BMPR2 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 19087-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

BMPR-2, BMPR II, BMPR 2, BMP type-2 receptor, BMP type II receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19087-1-AP targets BMPR2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5868

Product name: Recombinant human BMPR2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 172-504 aa of BC052985

Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL

Predict reactive species
Full Name bone morphogenetic protein receptor, type II (serine/threonine kinase)
Calculated Molecular Weight 115 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC052985
Gene Symbol BMPR2
Gene ID (NCBI) 659
RRIDAB_10603355
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13873
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. The dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form, and 150 kD dimer.

Protocols

Product Specific Protocols
IHC protocol for BMPR2 antibody 19087-1-APDownload protocol
IP protocol for BMPR2 antibody 19087-1-APDownload protocol
WB protocol for BMPR2 antibody 19087-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Theranostics

Polycomb repressive complex 1 modulates granulosa cell proliferation in early folliculogenesis to support female reproduction

Authors - Meng Gao
ratWB,IF

Basic Res Cardiol

The miR-182/Myadm axis regulates hypoxia-induced pulmonary hypertension by balancing the BMP- and TGF-β-signalling pathways in an SMC/EC-crosstalk-associated manner

Authors - Yongyi Bai
human

J Cell Biol

A PINCH-1-Smurf1 signaling axis mediates mechano-regulation of BMPR2 and stem cell differentiation.

Authors - Ling Guo

Sci Signal

Augmented noncanonical BMP type II receptor signaling mediates the synaptic abnormality of fragile X syndrome.

Authors - Risa Kashima
mouseWB

Am J Physiol Lung Cell Mol Physiol

Transforming growth factor-β plays divergent roles in modulating vascular remodeling, inflammation, and pulmonary fibrosis in a murine model of scleroderma

Authors - Kazuyuki Tsujino
mouseWB

Commun Biol

Bone morphogenetic protein signaling is required for RAD51-mediated maintenance of genome integrity in vascular endothelial cells.

Authors - Sanna Vattulainen-Collanus
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...