Use Able AI chat for product recommendations

BRAF Polyclonal antibody

BRAF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20899-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

B RAF1, BRAF1, EC:2.7.11.1, p94, Proto-oncogene B-Raf

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, HEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, NIH/3T3 cells
Positive IHC detected inhuman lymphoma tissue, human malignant melanoma tissue, human testis tissue, human thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20899-1-AP targets BRAF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15014

Product name: Recombinant human BRAF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 500-766 aa of BC101757

Sequence: NEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH

Predict reactive species
Full Name v-raf murine sarcoma viral oncogene homolog B1
Calculated Molecular Weight 766 aa, 84 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC101757
Gene Symbol BRAF
Gene ID (NCBI) 673
RRIDAB_2878760
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15056
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B-Raf proto-oncogene serine/threonine kinase(BRAF), is a protein belonging to the raf/mil family of serine/threonine protein kinases. BRAF plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. BRAF is associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. BRAF is also associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. BRAF plays a role in the PD-1/PDL-1 pathway. In some cancers, BRAF is activated by rearrangements that fuse its kinase domain to 5' partner genes and then has different molecular weights (PMID: 23890088). BRAF has several isoforms, the calculated molecular weight of BRAF is 84 kDa, but the observed molecular weight is about 65 kDa(isoform).

Protocols

Product Specific Protocols
IF protocol for BRAF antibody 20899-1-APDownload protocol
IHC protocol for BRAF antibody 20899-1-APDownload protocol
WB protocol for BRAF antibody 20899-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Acta Pharmacol Sin

1-Indanone retards cyst development in ADPKD mouse model by stabilizing tubulin and down-regulating anterograde transport of cilia

Authors - Xiao-Wei Li
humanWB

J Eur Acad Dermatol Venereol

Differentially expressed proteins identified by TMT proteomics analysis in children with verrucous epidermal naevi.

Authors - T Yuan
humanWB

Biochim Biophys Acta Mol Cell Res

IL-17 promotes melanoma through TRAF2 as a scaffold protein recruiting PIAS2 and ELAVL1 to induce EPHA5

Authors - Junfeng Du
humanWB

Front Immunol

Immune Dysfunction Mediated by the ceRNA Regulatory Network in Human Placenta Tissue of Intrahepatic Cholestasis Pregnancy.

Authors - Yuya Wang
humanWB

Life Sci

Network pharmacology and molecular docking reveal the mechanism of Scopoletin against non-small cell lung cancer.

Authors - Chong Yuan
humanWB

Biochem Biophys Res Commun

Sex hormone-binding globulin regulates the activity of the ERK pathway in the placentas of patients with gestational diabetes mellitus.

Authors - Xiaoyan Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (09-24-2025)

BRAF (in green) seemed to work weakly but specifically in human brain cortical samples of TSC marking some NeuN-positive neurons (in red)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
BRAF Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:20899-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...