Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, NIH/3T3 cells |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29293-1-AP targets BRWD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30902 Product name: Recombinant human BRWD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC064602 Sequence: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI Predict reactive species |
| Full Name | bromodomain and WD repeat domain containing 1 |
| Calculated Molecular Weight | 2320 aa, 263 kDa |
| Observed Molecular Weight | 263 kDa |
| GenBank Accession Number | BC064602 |
| Gene Symbol | BRWD1 |
| Gene ID (NCBI) | 54014 |
| RRID | AB_3086110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NSI6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BRWD1 (Bromodomain and WD repeat domain containing 1, also known as WDR9) has a predicted molecular weight of 263 kDa and contains tandem BROMO domains and WD40 repeats (PMID:12889071). One of the remarkable functions of BRWD1 was the coordinated repression of MYC and MYC target genes. At the Myc/MYC locus, in both mice and humans, BRWD1 specififically repressed distal enhancers, which are associated with lineage specifific expression (PMID:30250168). In addition,BRWD1 as a key epigenomic mediator of normal neurodevelopment and an important contributor to DS (Down syndrome)-related phenotypes (PMID:36289231).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BRWD1 antibody 29293-1-AP | Download protocol |
| WB protocol for BRWD1 antibody 29293-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







