Product Information
60349-3-PBS targets BSAP,PAX5 as part of a matched antibody pair:
MP50228-1: 60349-2-PBS capture and 60349-3-PBS detection (validated in Cytometric bead array)
MP50228-2: 60349-1-PBS capture and 60349-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16023 Product name: Recombinant human BSAP,PAX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 145-391 aa of BC156927 Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH Predict reactive species |
| Full Name | paired box 5 |
| Calculated Molecular Weight | 391 aa, 42 kDa |
| GenBank Accession Number | BC156927 |
| Gene Symbol | PAX5 |
| Gene ID (NCBI) | 5079 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q02548 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



