• Featured Product
  • KD/KO Validated

BSAP,PAX5 Monoclonal antibody, PBS Only (Capture)

BSAP,PAX5 Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 60349-1-PBS
Clone No.2H2D6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

PAX5, 2H2D6, B-cell-specific transcription factor, paired box 5, Paired box protein Pax 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60349-1-PBS targets BSAP,PAX5 as part of a matched antibody pair:

MP50228-2: 60349-1-PBS capture and 60349-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16023

Product name: Recombinant human BSAP,PAX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 145-391 aa of BC156927

Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Predict reactive species
Full Name paired box 5
Calculated Molecular Weight 391 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC156927
Gene Symbol PAX5
Gene ID (NCBI) 5079
RRIDAB_2881458
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ02548
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PAX5, also named B-cell specific activator protein (BSAP), is a member of the highly conserved paired box (PAX)-domain family of transcription factors. PAX5 is essential in normal B-cell lymphopoiesis. It is expressed in pro-B, pre-B and mature B lymphocytes but not in plasma cells. PAX5 is a common target in leukemogenesis of B-ALL ( B-lineage acute lymphoblastic leukemia) along with CDKN2A. Owing to its frequent deletion in B-ALL, PAX5 could be used as one of the molecular markers in diagnosis and monitoring of the disease. This antibody is specific to PAX5. It will not cross react with other PAX members.

Loading...
||
New chat

Able

正在加载,请稍候...