Betacellulin Monoclonal antibody, PBS Only

• 

  WB analysis using 66683-1-Ig (same clone as 66683-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 66683-1-Ig (same clone as 66683-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66683-1-Ig (same clone as 66683-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-231 using 66683-1-Ig (same clone as 66683-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 66683-1-Ig (same clone as 66683-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 66683-1-Ig (same clone as 66683-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66683-1-PBS in a different storage buffer formulation.

Betacellulin Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66683-1-PBS

Clone No.2H5E8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BTC, Probetacellulin, 2H5E8

---

Product Information

66683-1-PBS targets Betacellulin in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26724

  Product name: Recombinant human BTC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-118 aa of BC011618

  Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ

• Full Name: betacellulin
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC011618
• Gene Symbol: BTC
• Gene ID (NCBI): 685
• RRID: AB_2882037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35070
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.