Tested Applications
Positive WB detected in | MCF-7 cells, NCCIT cells, A549 cells, MDA-MB-231 cells, T-47D cells, PC-3 cells, BxPC-3 cells, DU 145 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
66683-1-Ig targets Betacellulin in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species |
Full Name | betacellulin |
Calculated Molecular Weight | 20 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC011618 |
Gene Symbol | BTC |
Gene ID (NCBI) | 685 |
RRID | AB_2882037 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P35070 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Betacellulin antibody 66683-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Invest Dermatol LPCAT1 promotes cutaneous squamous cell carcinoma via EGFR-mediated AKT/p38MAPK signaling pathways. | ||
Front Genet BTC as a Novel Biomarker Contributing to EMT via the PI3K-AKT Pathway in OSCC. |