Betacellulin Monoclonal antibody

• 

  WB analysis using 66683-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 66683-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 66683-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-231 using 66683-1-Ig

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of T-47D using 66683-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 66683-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66683-1-Ig (BTC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Betacellulin Monoclonal Antibody for WB, ELISA

Cat No. 66683-1-Ig

Clone No.2H5E8

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

BTC, Probetacellulin, 2H5E8

---

Tested Applications

• Positive WB detected in: MCF-7 cells, NCCIT cells, A549 cells, MDA-MB-231 cells, T-47D cells, PC-3 cells, BxPC-3 cells, DU 145 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

66683-1-Ig targets Betacellulin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26724

  Product name: Recombinant human BTC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-118 aa of BC011618

  Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ

• Full Name: betacellulin
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC011618
• Gene Symbol: BTC
• Gene ID (NCBI): 685
• RRID: AB_2882037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35070
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Invest Dermatol; LPCAT1 promotes cutaneous squamous cell carcinoma via EGFR-mediated AKT/p38MAPK signaling pathways.; Authors - Yingjian Huang
human	WB,IHC	Front Genet; BTC as a Novel Biomarker Contributing to EMT via the PI3K-AKT Pathway in OSCC.; Authors - Ting Shen