Tested Applications
Positive WB detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
21001-1-AP targets BZW2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15126 Product name: Recombinant human BZW2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-355 aa of BC003056 Sequence: MKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIH Predict reactive species |
Full Name | basic leucine zipper and W2 domains 2 |
Calculated Molecular Weight | 419 aa, 48 kDa |
Observed Molecular Weight | 45-48 kDa |
GenBank Accession Number | BC003056 |
Gene Symbol | BZW2 |
Gene ID (NCBI) | 28969 |
RRID | AB_2878787 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y6E2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BZW2 antibody 21001-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oncol Rep Downregulation of BZW2 inhibits osteosarcoma cell growth by inactivating the Akt/mTOR signaling pathway. | ||