Biglycan Monoclonal antibody

Biglycan Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67275-1-Ig
Clone No.1E3F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

WB, IHC, FC (Intra), ELISA

BGN, 1E3F2, PG-S1, PGI, PG S1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig skin tissue, HepG2 cells, pig colon tissue, mouse testis tissue
Positive IHC detected inhuman kidney tissue, human placenta tissue, human lung tissue, human lung cancer tissue, human colon cancer tissue, human stomach cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67275-1-Ig targets Biglycan in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8012

Product name: Recombinant human Biglycan protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-368 aa of BC004244

Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Predict reactive species
Full Name biglycan
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC004244
Gene Symbol Biglycan
Gene ID (NCBI) 633
RRIDAB_2882544
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21810
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Biglycan is a member of the small leucine-rich proteoglycan (SLRP) family (PMID: 18463092). It consists of a core protein of 42 kDa containing leucine-rich repeats (LRRs), to which two chondroitin/dermatan sulfate side chains are covalently bound (PMID: 2212616; 10383378). The tissue-specific chondroitin- or dermatan-sulfate glycosaminoglycan chains of biglycan are attached to amino acid residues at the N-terminus of the core protein (PMID: 22821552). Biglycan is a ubiquitous component of connective tissue matrix and may act as a signaling molecule (PMID: 22821552). Upregulation of biglycan has been reported in multiple types of solid cancer (PMID: 32194659).

Protocols

Product Specific Protocols
WB protocol for Biglycan antibody 67275-1-IgDownload protocol
IHC protocol for Biglycan antibody 67275-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

iScience

Biglycan regulated colorectal cancer progress by modulating enteric neuron-derived IL-10 and abundance of Bacteroides thetaiotaomicron

Authors - Yuyu Xu
humanIHC

Sci Rep

Exploring the mystery of colon cancer from the perspective of molecular subtypes and treatment

Authors - Wenhong Lu
Loading...
||
New chat Able
正在加载,请稍候...