Biglycan Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Biglycan Monoclonal antibody (67275-1-Ig)

Biglycan Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 67275-1-Ig Copied!

Clone No. 1E3F2

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

BGN, 1E3F2, DSPG1, PG S1, PGI

• 

  WB analysis of pig skin using 67275-1-Ig

  pig skin tissue were subjected to SDS PAGE followed by western blot with 67275-1-Ig (Biglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 67275-1-Ig

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 67275-1-Ig (Biglycan antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 67275-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67275-1-Ig (Biglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig colon using 67275-1-Ig

  pig colon tissue were subjected to SDS PAGE followed by western blot with 67275-1-Ig (Biglycan antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 67275-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67275-1-Ig (Biglycan antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 67275-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug Biglycan Monoclonal antibody (67275-1-Ig, Clone:1E3F2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG2a isotype control Mouse McAb (66360-2-Ig, Clone: 11A1B2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Biglycan in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig skin tissue, HepG2 cells, pig colon tissue, mouse testis tissue
• Positive IHC detected in: human kidney tissue, human placenta tissue, human lung tissue, human lung cancer tissue, human colon cancer tissue, human stomach cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67275-1-Ig targets Biglycan in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8012

  Product name: Recombinant human Biglycan protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC004244

  Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

• Full Name: biglycan
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC004244
• Gene Symbol: Biglycan
• Gene ID (NCBI): 633
• RRID: AB_2882544
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21810
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Biglycan is a member of the small leucine-rich proteoglycan (SLRP) family (PMID: 18463092). It consists of a core protein of 42 kDa containing leucine-rich repeats (LRRs), to which two chondroitin/dermatan sulfate side chains are covalently bound (PMID: 2212616; 10383378). The tissue-specific chondroitin- or dermatan-sulfate glycosaminoglycan chains of biglycan are attached to amino acid residues at the N-terminus of the core protein (PMID: 22821552). Biglycan is a ubiquitous component of connective tissue matrix and may act as a signaling molecule (PMID: 22821552). Upregulation of biglycan has been reported in multiple types of solid cancer (PMID: 32194659).

Publications

What published studies show

The Biglycan Monoclonal antibody (1E3F2), catalog number 67275-1-Ig, has 3 total citations. These appear in Scientific Reports, iScience, and Experimental Eye Research. The associated research fields include colon cancer molecular subtypes and treatment, colorectal cancer progression involving enteric neurons and gut microbiota, and corneal stroma proteomics related to myopia progression.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; Exploring the mystery of colon cancer from the perspective of molecular subtypes and treatment; Authors - Wenhong Lu
human	WB	iScience; Biglycan regulated colorectal cancer progress by modulating enteric neuron-derived IL-10 and abundance of Bacteroides thetaiotaomicron; Authors - Yuyu Xu
		Exp Eye Res; Proteomic profiling of human corneal stroma reveals molecular signatures associated with myopia progression.; Authors - Yahan Ju