C11orf67 Recombinant monoclonal antibody, PBS Only (Detector)

C11orf67 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA, WB
Cat No. 83603-4-PBS
Clone No.240530H5

Host / Isotype

Rabbit / IgG

Reactivity

rat, mouse, human

Applications

Cytometric bead array, Indirect ELISA, WB

PTD015, Mth938 domain-containing protein, CK067, Adipogenesis associated Mth938 domain-containing protein, AAMDC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83603-4-PBS targets C11orf67 as part of a matched antibody pair:

MP00605-1: 83603-3-PBS capture and 83603-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity rat, mouse, human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14258

Product name: Recombinant human C11orf67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-122 aa of BC002752

Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

Predict reactive species
Full Name chromosome 11 open reading frame 67
Calculated Molecular Weight 122 aa, 13 kDa
GenBank Accession NumberBC002752
Gene Symbol C11orf67
Gene ID (NCBI) 28971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H7C9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

C11orf67 is predicted to be involved in positive regulation of fat cell differentiation.

Loading...
||
New chat

Able

正在加载,请稍候...