Product Information
83603-4-PBS targets C11orf67 as part of a matched antibody pair:
MP00605-1: 83603-3-PBS capture and 83603-4-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | rat, mouse, human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species |
| Full Name | chromosome 11 open reading frame 67 |
| Calculated Molecular Weight | 122 aa, 13 kDa |
| GenBank Accession Number | BC002752 |
| Gene Symbol | C11orf67 |
| Gene ID (NCBI) | 28971 |
| RRID | AB_3671217 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H7C9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
C11orf67 is predicted to be involved in positive regulation of fat cell differentiation.





