C13orf18 Polyclonal antibody, PBS Only

• 

  WB analysis of human skeletal muscle using 21183-1-AP (same clone as 21183-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21183-1-AP (C13orf18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 21183-1-AP (same clone as 21183-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21183-1-AP (C13orf18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21183-1-AP (C13orf18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 21183-1-AP (C13orf18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21183-1-AP (same clone as 21183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 21183-1-AP (same clone as 21183-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using C13orf18 antibody (21183-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21183-1-PBS in a different storage buffer formulation.

C13orf18 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21183-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Pacer, Protein associated with UVRAG as autophagy enhancer, Protein Rubicon-like, RUBCNL

---

Product Information

21183-1-PBS targets C13orf18 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15474

  Product name: Recombinant human C13orf18 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-306 aa of BC032311

  Sequence: MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQVPAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFV

• Full Name: chromosome 13 open reading frame 18
• Calculated Molecular Weight: 662 aa, 73 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC032311
• Gene Symbol: C13orf18
• Gene ID (NCBI): 80183
• RRID: AB_10733098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H714
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C13orf18 (also known as Pacer), now formally designated RUBCNL (Rubicon-like autophagy enhancer), is a protein containing an EF-hand calcium-binding domain with potential transporter functions. Initially identified as a candidate tumor suppressor gene, it is frequently silenced in cervical cancer due to promoter hypermethylation. Its re-expression inhibits cervical cancer cell proliferation, suggesting tumor-suppressing activity. Furthermore, research has revealed that polymorphisms in the 3'UTR region of the C13orf18 gene are associated with amyotrophic lateral sclerosis (ALS), suggesting its potential involvement in autophagy regulation and the pathogenesis of neurodegenerative diseases.