C13orf18 Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 21183-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21183-1-AP (C13orf18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 21183-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21183-1-AP (C13orf18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 21183-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21183-1-AP (C13orf18 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of U-251 using 21183-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using C13orf18 antibody (21183-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

C13orf18 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21183-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Pacer, Protein associated with UVRAG as autophagy enhancer, Protein Rubicon-like, RUBCNL

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, MCF-7 cells
• Positive IHC detected in: human testis tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

21183-1-AP targets C13orf18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15474

  Product name: Recombinant human C13orf18 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-306 aa of BC032311

  Sequence: MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQVPAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFV

• Full Name: chromosome 13 open reading frame 18
• Calculated Molecular Weight: 662 aa, 73 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC032311
• Gene Symbol: C13orf18
• Gene ID (NCBI): 80183
• RRID: AB_10733098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C13orf18 (also known as Pacer), now formally designated RUBCNL (Rubicon-like autophagy enhancer), is a protein containing an EF-hand calcium-binding domain with potential transporter functions. Initially identified as a candidate tumor suppressor gene, it is frequently silenced in cervical cancer due to promoter hypermethylation. Its re-expression inhibits cervical cancer cell proliferation, suggesting tumor-suppressing activity. Furthermore, research has revealed that polymorphisms in the 3'UTR region of the C13orf18 gene are associated with amyotrophic lateral sclerosis (ALS), suggesting its potential involvement in autophagy regulation and the pathogenesis of neurodegenerative diseases.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Architecture of the human interactome defines protein communities and disease networks.; Authors - Edward L Huttlin
human	WB	Precis Clin Med; Blockade of Syk modulates neutrophil immune-responses via the mTOR/RUBCNL-dependent autophagy pathway to alleviate intestinal inflammation in ulcerative colitis; Authors - Fengqin Zhu