C1QA Recombinant monoclonal antibody

• 

  WB analysis using 85719-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85719-4-RR (C1QA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 85719-4-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85719-4-RR (C1QA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 85719-4-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C1QA antibody (85719-4-RR, Clone: 250093H1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C1QA Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85719-4-RR

Clone No.250093H1

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Complement C1q A chain

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse lung tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

85719-4-RR targets C1QA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2396

  Product name: Recombinant Human C1QA protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 23-245 aa of NM_015991.4

  Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

• Full Name: complement component 1, q subcomponent, A chain
• Calculated Molecular Weight: 26kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: NM_015991.4
• Gene Symbol: C1QA
• Gene ID (NCBI): 712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02745
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Invest Ophthalmol Vis Sci; Early Transcriptomic and Pathologic Changes of Col8a2 Mutant Fuchs Endothelial Corneal Dystrophy.; Authors - Xintian Zhao