CoraLite® Plus 488-conjugated C1QA Recombinant monoclonal antibody

C1QA Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85719-4
Clone No.250093H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Complement C1q A chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85719-4 targets C1QA in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2396

Product name: Recombinant Human C1QA protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 23-245 aa of NM_015991.4

Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Predict reactive species
Full Name complement component 1, q subcomponent, A chain
Calculated Molecular Weight26kDa
Observed Molecular Weight 26-30 kDa
GenBank Accession NumberNM_015991.4
Gene Symbol C1QA
Gene ID (NCBI) 712
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02745
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 C1QA antibody CL488-85719-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...