• Featured Product
  • KD/KO Validated

C1QBP Polyclonal antibody

C1QBP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24474-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

gC1Q R, ASF/SF2-associated protein p32, Complement component 1 Q subcomponent-binding protein, mitochondrial, GC1q R protein, GC1QBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC2C12 cells, HEK-293 cells, HCT 116 cells, HeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells, RAW 264.7 cells
Positive IHC detected inhuman tonsillitis tissue, human breast cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24474-1-AP targets C1QBP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19773

Product name: Recombinant human C1QBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-282 aa of BC013731

Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Predict reactive species
Full Name complement component 1, q subcomponent binding protein
Calculated Molecular Weight 282 aa, 31 kDa
Observed Molecular Weight 32-35 kDa
GenBank Accession NumberBC013731
Gene Symbol C1QBP
Gene ID (NCBI) 708
RRIDAB_2827427
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07021
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).

Protocols

Product Specific Protocols
IF protocol for C1QBP antibody 24474-1-APDownload protocol
IHC protocol for C1QBP antibody 24474-1-APDownload protocol
WB protocol for C1QBP antibody 24474-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Blood

C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse

Authors - Li-Xue Yang
  • KO Validated
humanWB

Proc Natl Acad Sci U S A

A nucleolar long "non-coding" RNA encodes a novel protein that functions in response to stress

Authors - Shuang Feng
humanWB

J Control Release

PSMA-targeted nanoparticles for specific penetration of blood-brain tumor barrier and combined therapy of brain metastases.

Authors - Jiang Ni
ratIHC

J Ethnopharmacol

Exploring the therapeutic effects and molecular mechanisms of total flavonoids of Abelmoschus manihot (L.) Medic in the treatment of IgA nephropathy based on WGCNA

Authors - Changqing Wen
mouseWB

Cancer Sci

Complement C1q binding protein regulates T cells' mitochondrial fitness to affect their survival, proliferation, and anti-tumor immune function.

Authors - Hui Tian
  • KO Validated
WB,IF

Int J Mol Sci

The Expression Pattern of p32 in Sheep Muscle and Its Role in Differentiation, Cell Proliferation, and Apoptosis of Myoblasts.

Authors - Jianyu Ma
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Annabel (Verified Customer) (12-23-2025)

Produces a single band by western blot, imaged using blotting accelerator.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: B Cells, human and mouse
C1QBP Antibody Western Blot validation (1:1000 dilution) in B Cells, human and mouse (Cat no:24474-1-AP)
FH

Lana (Verified Customer) (08-13-2019)

SDS-PAGE: 15 ug/ul RIPA lysate of the mitochondrial fraction of HEK293t. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h.Primary Ab: O/N incubation at 4C.Secondary Ab: IRDye 800CW Goat anti-Rabbit.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEK293t
C1QBP Antibody Western Blot, validation (1:500 dilution) in HEK293t (Cat no:24474-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...