C1orf77 Recombinant monoclonal antibody

• 

  WB analysis using 85147-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85147-3-RR (C1orf77 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 85147-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85147-3-RR (C1orf77 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 85147-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85147-3-RR (C1orf77 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 85147-3-RR

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 85147-3-RR (C1orf77 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 85147-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using C1orf77 antibody (85147-3-RR, Clone: 242770H3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of SH-SY5Y using 85147-3-RR

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using C1orf77 antibody (85147-3-RR, Clone: 242770H3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of A431 using 85147-3-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using C1orf77 antibody (85147-3-RR, Clone: 242770H3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 85147-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85147-3-RR against Human C1orf77 were performed. The affinity constant is 9.63 nM.

C1orf77 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85147-3-RR

Clone No.242770H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CHTOP, FOP, 242770H3, Friend of PRMT1 protein, PP7704

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HEK-293T cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells, HeLa cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85147-3-RR targets C1orf77 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26580

  Product name: Recombinant human C1orf77 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC002733

  Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND

• Full Name: chromosome 1 open reading frame 77
• Calculated Molecular Weight: 248 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC002733
• Gene Symbol: C1orf77
• Gene ID (NCBI): 26097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3Y2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.