Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells, HEK-293T cells, THP-1 cells |
Positive IHC detected in | human colon cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | SH-SY5Y cells, HeLa cells, A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
85147-3-RR targets C1orf77 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species |
Full Name | chromosome 1 open reading frame 77 |
Calculated Molecular Weight | 248 aa, 26 kDa |
Observed Molecular Weight | 26-30 kDa |
GenBank Accession Number | BC002733 |
Gene Symbol | C1orf77 |
Gene ID (NCBI) | 26097 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9Y3Y2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C1orf77 antibody 85147-3-RR | Download protocol |
IHC protocol for C1orf77 antibody 85147-3-RR | Download protocol |
IF protocol for C1orf77 antibody 85147-3-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |