Filter:
Tested Applications
| Positive IF/ICC detected in | HeLa cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-85147-3 targets C1orf77 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species |
| Full Name | chromosome 1 open reading frame 77 |
| Calculated Molecular Weight | 248 aa, 26 kDa |
| Observed Molecular Weight | 26-30 kDa |
| GenBank Accession Number | BC002733 |
| Gene Symbol | C1orf77 |
| Gene ID (NCBI) | 26097 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9Y3Y2 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
C1orf77, officially designated CHTOP (Chromatin Target of PRMT1), is a small nuclear protein encoded on human chromosome 1q21.3.
