Tested Applications
Positive IF/ICC detected in | HeLa cells, A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-85147-3 targets C1orf77 in IF/ICC applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species |
Full Name | chromosome 1 open reading frame 77 |
Calculated Molecular Weight | 248 aa, 26 kDa |
Observed Molecular Weight | 26-30 kDa |
GenBank Accession Number | BC002733 |
Gene Symbol | C1orf77 |
Gene ID (NCBI) | 26097 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9Y3Y2 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
C1orf77, officially designated CHTOP (Chromatin Target of PRMT1), is a small nuclear protein encoded on human chromosome 1q21.3.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 C1orf77 antibody CL488-85147-3 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |